Animal-Free GDNF, Human (His)
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Human (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free GDNF Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-human-his.html
Purity
95.0
Smiles
MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Molecular Formula
2668 (Gene_ID) P39905-1 (S78-I211) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Sheep Coiled coil domain containing protein 129 (CCDC129) ELISA kit
Lentiviral human LRIG1 shRNA (UAS) - Lentiviral human LRIG1 shRNA (UAS, GFP) plasmid
SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (FITC) discontinued