CD276/B7-H3, Human (HEK293, His)
CD276/B7-H3 Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.
Product Specifications
Product Name Alternative
CD276/B7-H3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h3-icoslg-protein-human-435a-a-hek293-his.html
Purity
95.00
Smiles
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Molecular Formula
80381 (Gene_ID) Q5ZPR3-2 (L29-P245) (Accession)
Molecular Weight
Approximately 38-50 kDa, based on SDS-PAGE or Bis-Tris PAGE under reducing conditions.
References & Citations
[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15331755 1 Vial
Lentiviral human CLPSL2 shRNA (UAS) - Lentiviral human CLPSL2 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
RR215224L4V 200 µL
Ntrk3 (NM_019248) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details