Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein NDNF (Ndnf)

Product Specifications

Product Name Alternative

Epidermacan; Neuron-derived neurotrophic factor

Abbreviation

Recombinant Mouse Ndnf protein

Gene Name

Ndnf

UniProt

Q8C119

Expression Region

20-568aa

Organism

Mus musculus (Mouse)

Target Sequence

QKLPTRDEELFQMQIRDKEFFHDSSVIPDGAEVSSYLFRDTPRRYFFMVEEDNTPLSVTVTPCDAPLEWKLSLQELHEGSSADGSGDPELLDQQKQQMTDVEGTELFSYKGNDVEYFLSSSSPSGLYQLELLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSFGRTTVTLAWKPSPTASILKQPIEYCVVINKEHNFKSLCAAETKMNADDAFMVAPKPGLDFNPFDFAHFGFPTDNLGKDRSLLAKPSPKVGRHVYWRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFMVNTNTNMSTAYVGAFVRTKEEAKQKTVELKDGRVTDVFVKRKGKKFLRFAPVSSHQKVTFFIHSCMDAVQVQVRRDGRLLLSQNVEGIRQFQLRGKPKGKYLIRLKGNRKGASKLKILATTRPSKHAFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERRKFCIYRKEVDGNYSEDQKRREQNQCLGPDTRKKSEKVLCKYFHSQNLQKAVTTETIRDLQPGKSYLLDVYVVGHGGHSVKYQSKIVKTRKVC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Secretory protein that plays a role in various cellular processes. Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the hypothalamus. Also promotes neuron migration, growth and survival as well as neurite outgrowth and is involved in the development of the olfactory system. May also act through the regulation of growth factors activity and downstream signaling. Also regulates extracellular matrix assembly and cell adhesiveness. Promotes endothelial cell survival, vessel formation and plays an important role in the process of revascularization through NOS3-dependent mechanisms.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI14 Antibody, HRP conjugated
A67865-50UG 50 µg

RAI14 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal WDR45 Antibody [Janelia Fluor 669]
NBP3-18255JF669 0.1 mL

Rabbit Polyclonal WDR45 Antibody [Janelia Fluor 669]

Sign In for Pricing
View Details
Pkdrej Rat shRNA Lentiviral Particle (Locus ID 300124)
TL708868V 500 µL Each

Pkdrej Rat shRNA Lentiviral Particle (Locus ID 300124)

Sign In for Pricing
View Details
C10orf82 Antibody, HRP conjugated
CSB-PA837861LB01HU-01 50 µg

C10orf82 Antibody, HRP conjugated

Sign In for Pricing
View Details
C10orf82 Antibody, HRP conjugated
CSB-PA837861LB01HU-02 100 µg

C10orf82 Antibody, HRP conjugated

Sign In for Pricing
View Details
E2F6 siRNA (Human)
CRH1311-01 15 nmol

E2F6 siRNA (Human)

Sign In for Pricing
View Details