Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein NDNF (Ndnf)

Product Specifications

Product Name Alternative

Epidermacan; Neuron-derived neurotrophic factor

Abbreviation

Recombinant Mouse Ndnf protein

Gene Name

Ndnf

UniProt

Q8C119

Expression Region

20-568aa

Organism

Mus musculus (Mouse)

Target Sequence

QKLPTRDEELFQMQIRDKEFFHDSSVIPDGAEVSSYLFRDTPRRYFFMVEEDNTPLSVTVTPCDAPLEWKLSLQELHEGSSADGSGDPELLDQQKQQMTDVEGTELFSYKGNDVEYFLSSSSPSGLYQLELLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSFGRTTVTLAWKPSPTASILKQPIEYCVVINKEHNFKSLCAAETKMNADDAFMVAPKPGLDFNPFDFAHFGFPTDNLGKDRSLLAKPSPKVGRHVYWRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFMVNTNTNMSTAYVGAFVRTKEEAKQKTVELKDGRVTDVFVKRKGKKFLRFAPVSSHQKVTFFIHSCMDAVQVQVRRDGRLLLSQNVEGIRQFQLRGKPKGKYLIRLKGNRKGASKLKILATTRPSKHAFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERRKFCIYRKEVDGNYSEDQKRREQNQCLGPDTRKKSEKVLCKYFHSQNLQKAVTTETIRDLQPGKSYLLDVYVVGHGGHSVKYQSKIVKTRKVC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Secretory protein that plays a role in various cellular processes. Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the hypothalamus. Also promotes neuron migration, growth and survival as well as neurite outgrowth and is involved in the development of the olfactory system. May also act through the regulation of growth factors activity and downstream signaling. Also regulates extracellular matrix assembly and cell adhesiveness. Promotes endothelial cell survival, vessel formation and plays an important role in the process of revascularization through NOS3-dependent mechanisms.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGCR6 (NM_005675) Human Tagged ORF Clone
RG208368 10 µg

DGCR6 (NM_005675) Human Tagged ORF Clone

Sign In for Pricing
View Details
K Cadherin (CDH6) Human Gene Knockout Kit (CRISPR)
KN417889 1 Kit

K Cadherin (CDH6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Anti-Mouse CD90 mAb (PE/Cy7) [M5/49.4.1]
E2782210 100 Tests

Rat Anti-Mouse CD90 mAb (PE/Cy7) [M5/49.4.1]

Sign In for Pricing
View Details
pLV2-CMV-RELA-GAL4-VP64-Puro Plasmid
PVT54786 2 µg

pLV2-CMV-RELA-GAL4-VP64-Puro Plasmid

Sign In for Pricing
View Details
DNA ligase 1
322393 100 µL

DNA ligase 1

Sign In for Pricing
View Details
Rabbit Polyclonal Nucleostemin Antibody
NB100-1568 0.1 mL

Rabbit Polyclonal Nucleostemin Antibody

Sign In for Pricing
View Details