Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCR, Human (His)

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGCR Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgcr-protein-human-his.html

Purity

90.00

Smiles

MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT

Molecular Formula

3156 (Gene_ID) P04035-1 (M588-T887) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS2R50 Antibody
MBS8513546-01 0.05 mg

TAS2R50 Antibody

Sign In for Pricing
View Details
TAS2R50 Antibody
MBS8513546-02 0.1 mg

TAS2R50 Antibody

Sign In for Pricing
View Details
TAS2R50 Antibody
MBS8513546-03 0.1 mL (AF750)

TAS2R50 Antibody

Sign In for Pricing
View Details
TAS2R50 Antibody
MBS8513546-04 0.1 mL (AF405M)

TAS2R50 Antibody

Sign In for Pricing
View Details
TAS2R50 Antibody
MBS8513546-05 0.1 mL (AF546)

TAS2R50 Antibody

Sign In for Pricing
View Details
TAS2R50 Antibody
MBS8513546-06 0.1 mL (AF405L)

TAS2R50 Antibody

Sign In for Pricing
View Details