Serum amyloid A, Cat (P.pastoris, His)
Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
Serum amyloid A protein, Cat (P.pastoris, His), Cat, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/serum-amyloid-a-protein-cat-p-pastoris-his.html
Smiles
EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Molecular Formula
101099498 (Gene_ID) P19707 (E1-G90) (Accession)
Molecular Weight
Approximately 12.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog