Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D1A, Human (His)

SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7) . SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SH2D1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sh2d1a-protein-human-his.html

Purity

95.0

Smiles

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Molecular Formula

4068 (Gene_ID) O60880 (M1-P128) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINE2 Adenovirus (Human)
43500051 1.0 mL

SERPINE2 Adenovirus (Human)

Sign In for Pricing
View Details
Bovine Immunoglobulin G1 (IgG1) ELISA Kit
AE38637BO-01 48 Tests

Bovine Immunoglobulin G1 (IgG1) ELISA Kit

Sign In for Pricing
View Details
Bovine Immunoglobulin G1 (IgG1) ELISA Kit
AE38637BO-02 96 Tests

Bovine Immunoglobulin G1 (IgG1) ELISA Kit

Sign In for Pricing
View Details
Rat Bax inhibitor 1 (TMBIM6) ELISA Kit
MBS7238500-01 48 Well

Rat Bax inhibitor 1 (TMBIM6) ELISA Kit

Sign In for Pricing
View Details
Rat Bax inhibitor 1 (TMBIM6) ELISA Kit
MBS7238500-02 96 Well

Rat Bax inhibitor 1 (TMBIM6) ELISA Kit

Sign In for Pricing
View Details
Rat Bax inhibitor 1 (TMBIM6) ELISA Kit
MBS7238500-03 5x 96 Well

Rat Bax inhibitor 1 (TMBIM6) ELISA Kit

Sign In for Pricing
View Details