Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epidermal growth factor receptor substrate 15 (EPS15), partial

Product Specifications

Product Name Alternative

(Protein Eps15) (Protein AF-1p)

Abbreviation

Recombinant Human EPS15 protein, partial

Gene Name

EPS15

UniProt

P42566

Expression Region

657-798aa

Organism

Homo sapiens (Human)

Target Sequence

CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits (CCPs) . Acts as a clathrin adapter required for post-Golgi trafficking. Seems to be involved in CCPs maturation including invagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR) ; internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

References & Citations

"An endosomally localized isoform of Eps15 interacts with Hrs to mediate degradation of epidermal growth factor receptor." Roxrud I., Raiborg C., Pedersen N.M., Stang E., Stenmark H. J. Cell Biol. 180:1205-1218 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPSM2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0901802 1.0 µg DNA

GPSM2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Pig Peptide YY (PYY) ELISA Kit
E111200 1 Each

Pig Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
SKP1 antibody
70R-20292 50 μL

SKP1 antibody

Sign In for Pricing
View Details
Human ANGPTL5 shRNA Plasmid
abx966656-01 150 µg

Human ANGPTL5 shRNA Plasmid

Sign In for Pricing
View Details
Human ANGPTL5 shRNA Plasmid
abx966656-02 300 µg

Human ANGPTL5 shRNA Plasmid

Sign In for Pricing
View Details
Hsa-miR-194-5p antagomir
HY-RI00384A-01 5 nmol

Hsa-miR-194-5p antagomir

Sign In for Pricing
View Details