Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTP4A2, Human (His)

The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PTP4A2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptp4a2-protein-human-his.html

Purity

95.00

Smiles

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ

Molecular Formula

8073 (Gene_ID) Q12974 (M1-Q167) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIT1 Antibody - middle region
MBS3222592-01 0.1 mL

RIT1 Antibody - middle region

Sign In for Pricing
View Details
RIT1 Antibody - middle region
MBS3222592-02 5x 0.1 mL

RIT1 Antibody - middle region

Sign In for Pricing
View Details
Nudifloric Acid
orb1220593-01 200 mg

Nudifloric Acid

Sign In for Pricing
View Details
Nudifloric Acid
orb1220593-02 500 mg

Nudifloric Acid

Sign In for Pricing
View Details
Nudifloric Acid
orb1220593-03 1 g

Nudifloric Acid

Sign In for Pricing
View Details
Nudifloric Acid
orb1220593-04 100 mg

Nudifloric Acid

Sign In for Pricing
View Details