PTP4A2, Human (His)
The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
PTP4A2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ptp4a2-protein-human-his.html
Purity
95.00
Smiles
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Molecular Formula
8073 (Gene_ID) Q12974 (M1-Q167) (Accession)
Molecular Weight
Approximately 20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Poly (styrenesulfonic acid), sodium salt [MW ~ 18,000]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
16250-250 250 mg
Poly (styrenesulfonic acid), sodium salt [MW ~ 18,000]
Sign In for Pricing
View Details 
T5595-5681 5 Sections
Tissue, Section, Human Tumor, Parotid Tumor, Pleomorphic Adenoma (Paraffin) HisTekTM
Sign In for Pricing
View Details 
abx680119-01 1 µg
Human NKG2-A/NKG2-B Type II Integral Membrane Protein (KLRC1) Protein
Sign In for Pricing
View Details abx680119-02 5 µg
Human NKG2-A/NKG2-B Type II Integral Membrane Protein (KLRC1) Protein
Sign In for Pricing
View Details abx680119-03 50 µg
Human NKG2-A/NKG2-B Type II Integral Membrane Protein (KLRC1) Protein
Sign In for Pricing
View Details