Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Mouse (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals. CD40 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR

Molecular Formula

21939 (Gene_ID) P27512-1 (L20-R193) (Accession)

Molecular Weight

21-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK124576A
T32001 25 mg

GSK124576A

Sign In for Pricing
View Details
CD34 Rabbit mAb
AB101809 100 µL

CD34 Rabbit mAb

Sign In for Pricing
View Details
4430402I18Rik (NM_198651) Mouse Untagged Clone
MC214693 10 µg

4430402I18Rik (NM_198651) Mouse Untagged Clone

Sign In for Pricing
View Details
FOXC2, CT (P198) (FOXC2, FKHL14, MFH1, Forkhead box protein C2, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, Transcription factor FKH-14) (APC) discontinued
035724-APC 200 µL

FOXC2, CT (P198) (FOXC2, FKHL14, MFH1, Forkhead box protein C2, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, Transcription factor FKH-14) (APC) discontinued

Sign In for Pricing
View Details
HERG (F-3)
sc-515611 200 µg/mL

HERG (F-3)

Sign In for Pricing
View Details
SHPRH Rabbit pAb
E47R6104 100 µL

SHPRH Rabbit pAb

Sign In for Pricing
View Details