Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293, His)

IL-4 Protein, Mouse (HEK293, His) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.IL-4 Protein, Mouse (HEK293, His) is a recombinant mouse interleukin-4 (rhIL-4) expressed in HEK 293 cells with a His tag.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293-his.html

Purity

98.0

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]I-Cheng Ho, et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VEGFA
Y058474 100 µL

Anti-VEGFA

Sign In for Pricing
View Details
Human FRMD6 activation kit by CRISPRa
GA114788 1 Kit

Human FRMD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Mucolipin 3 (MCOLN3) Human Gene Knockout Kit (CRISPR)
KN424697 1 Kit

Mucolipin 3 (MCOLN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS627328 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
TMPRSS12 Human qPCR Primer Pair (NM_182559)
HP219104 200 Reactions

TMPRSS12 Human qPCR Primer Pair (NM_182559)

Sign In for Pricing
View Details
QK1 (QKI) Mouse Monoclonal Antibody [Clone ID: N182/17]
75-190 100 µL

QK1 (QKI) Mouse Monoclonal Antibody [Clone ID: N182/17]

Sign In for Pricing
View Details