Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293, His)

IL-4 Protein, Mouse (HEK293, His) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.IL-4 Protein, Mouse (HEK293, His) is a recombinant mouse interleukin-4 (rhIL-4) expressed in HEK 293 cells with a His tag.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293-his.html

Purity

98.0

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]I-Cheng Ho, et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOB1 activation kit by CRISPRa
GA109192 1 Kit

Human NOB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Necrosulfonamide
TRC-N388600-1MG 1 mg

Necrosulfonamide

Sign In for Pricing
View Details
TRIM16L Human Gene Knockout Kit (CRISPR)
KN414981 1 Kit

TRIM16L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Epoxide hydrolase (EPHX1) Human Gene Knockout Kit (CRISPR)
KN400621 1 Kit

Epoxide hydrolase (EPHX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Hydroxy-6-pentyl-2H-pyran-2-one
TRC-H283183-5MG 5 mg

4-Hydroxy-6-pentyl-2H-pyran-2-one

Sign In for Pricing
View Details
Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate
LC431248 20 µg

Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate

Sign In for Pricing
View Details