ASB13, Human (His)
ASB13 Protein, Human (His) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins, with an N-terminal His tag[1].
Product Specifications
Product Name Alternative
ASB13 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/asb13-protein-human-his.html
Smiles
HHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Molecular Formula
79754 (Gene_ID) Q8WXK3-1 (M1-N278) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Junya Kohroki , et al. ASB Proteins Interact With Cullin5 and Rbx2 to Form E3 Ubiquitin Ligase Complexes. FEBS Lett. 2005 Dec 19;579 (30) :6796-802.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A2295-28C-ML550 100 µL
ANXA3, ID (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
HK207957 1 Kit
WDR85 (DPH7) Human qPCR Template Standard (NM_138778)
Sign In for Pricing
View Details ![[Tyr11]-Urocortin (11-40) amide (Human)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)