ASB13, Human (His)
ASB13 Protein, Human (His) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins, with an N-terminal His tag[1].
Product Specifications
Product Name Alternative
ASB13 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/asb13-protein-human-his.html
Smiles
HHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Molecular Formula
79754 (Gene_ID) Q8WXK3-1 (M1-N278) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Junya Kohroki , et al. ASB Proteins Interact With Cullin5 and Rbx2 to Form E3 Ubiquitin Ligase Complexes. FEBS Lett. 2005 Dec 19;579 (30) :6796-802.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV659072 1.0 µg DNA
SPON2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details orb3008911-01 20 µg
Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated
Sign In for Pricing
View Details orb3008911-02 100 µg
Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated
Sign In for Pricing
View Details orb3008911-03 1 mg
Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated
Sign In for Pricing
View Details 
K3541402 1.0 µg DNA
Plac1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details