Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenococcus oeni Malolactic enzyme (mleA), partial

Product Specifications

Product Name Alternative

(MLE)

Abbreviation

Recombinant Oenococcus oeni mleA protein, partial

Gene Name

MleA

UniProt

Q48796

Expression Region

260-516aa

Organism

Oenococcus oeni (Leuconostoc oenos)

Target Sequence

IQGTGIVVLAGVLGALKISGQKLTDQTYMSFGAGTAGMGIVKQLHEEMVEQGLSDEEAKKHFFLVDKQGLLFDDDPDLTPEQKPFAAKRSDFKNANQLTNLQAAVEAVHPTILVGTSTHPNSFTEEIVKDMSGYTERPIIFPISNPTKLAEAKAEDVLKWSNGKALIGTGVPVDDIEYEGNAYQIGQANNALIYPGLGFGAIAAQSKLLTPEMISAAAHSLGGIVDTTKVGAAVLPPVSKLADFSRTVAVAVAKKAV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the malolactic fermentation (MLF) of wine, which results in a natural decrease in acidity and favorable changes in wine flavors. Catalyzes the decarboxylation of L-malate to L-lactate. It can also use pyruvate as substrate.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

References & Citations

"Malolactic enzyme from Oenococcus oeni: heterologous expression in Escherichia coli and biochemical characterization." Schuemann C., Michlmayr H., Del Hierro A.M., Kulbe K.D., Jiranek V., Eder R., Nguyen T.H. Bioengineered 4:147-152 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF652 (NM_001145365) Human Over-expression Lysate
LY428846 100 µg

ZNF652 (NM_001145365) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA392632 100 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DENND10 (NM_207009) Human Recombinant Protein
TP304659M 100 µg

DENND10 (NM_207009) Human Recombinant Protein

Sign In for Pricing
View Details
Proliferation Marker (JC1), CF568 conjugate, 0.1mg/mL
BNC683329-100 1x 100 µL

Proliferation Marker (JC1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCDC85C (NM_001144995) Human Over-expression Lysate
LY428630 100 µg

CCDC85C (NM_001144995) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS620100 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details