Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17C, Human (HEK293, His)

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

IL-17C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17c-protein-human-hek293-his.html

Purity

97.91

Smiles

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Molecular Formula

27189 (Gene_ID) Q9P0M4 (H19-V197) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Swedik S, et al. IL-17C in human mucosal immunity: More than just a middle child. Cytokine. 2021 Oct;146:155641.|[2]Lauffer F, et al. IL-17C amplifies epithelial inflammation in human psoriasis and atopic eczema. J Eur Acad Dermatol Venereol. 2020 Apr;34 (4) :800-809.|[3]Johnston A, et al. Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation. J Immunol. 2013 Mar 1;190 (5) :2252-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB11 Antibody
AF7593-01 50 µL

ABCB11 Antibody

Sign In for Pricing
View Details
ABCB11 Antibody
AF7593-02 100 µL

ABCB11 Antibody

Sign In for Pricing
View Details
ABCB11 Antibody
AF7593-03 200 µL

ABCB11 Antibody

Sign In for Pricing
View Details
Lentiviral human SETD9 shRNA (UAS) - Lentiviral human SETD9 shRNA (UAS, GFP) (100)
GTR15105345 1 Vial

Lentiviral human SETD9 shRNA (UAS) - Lentiviral human SETD9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rat NT3 (Neurotrophin 3) ELISA Kit
ER21680 96 Tests

Rat NT3 (Neurotrophin 3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ATG5 Antibody (rATG5/2553) [Alexa Fluor 647]
NBP3-08452AF647 100 µL

Mouse Monoclonal ATG5 Antibody (rATG5/2553) [Alexa Fluor 647]

Sign In for Pricing
View Details