Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AKIRIN1 Antibody [DyLight 650]
NBP2-81700C 0.1 mL

Rabbit Polyclonal AKIRIN1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Climatic Chamber BCCL-1413
BCCL-1413 1 Unit

Climatic Chamber BCCL-1413

Sign In for Pricing
View Details
MTOHR 3'UTR Luciferase Stable Cell Line
TU014920 1.0 mL

MTOHR 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT
ELI-23752b 96 Tests

Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT

Sign In for Pricing
View Details
CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (APC)
MBS6288847-01 0.2 mL

CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (APC)

Sign In for Pricing
View Details
CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (APC)
MBS6288847-02 5x 0.2 mL

CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (APC)

Sign In for Pricing
View Details