Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISG20 (Interferon Stimulated Exonuclease Gene 20kD, CD25, HEM45) (MaxLight 550)
247736-ML550 100 µL

ISG20 (Interferon Stimulated Exonuclease Gene 20kD, CD25, HEM45) (MaxLight 550)

Sign In for Pricing
View Details
OR1Q1, CT (OR1Q1, OR1Q2, OR1Q3, Olfactory receptor 1Q1, OST226, Olfactory receptor 1Q2, Olfactory receptor 1Q3, Olfactory receptor 9-A, Olfactory receptor OR9-25, Olfactory receptor TPCR106) (AP)
MBS6328250-01 0.2 mL

OR1Q1, CT (OR1Q1, OR1Q2, OR1Q3, Olfactory receptor 1Q1, OST226, Olfactory receptor 1Q2, Olfactory receptor 1Q3, Olfactory receptor 9-A, Olfactory receptor OR9-25, Olfactory receptor TPCR106) (AP)

Sign In for Pricing
View Details
OR1Q1, CT (OR1Q1, OR1Q2, OR1Q3, Olfactory receptor 1Q1, OST226, Olfactory receptor 1Q2, Olfactory receptor 1Q3, Olfactory receptor 9-A, Olfactory receptor OR9-25, Olfactory receptor TPCR106) (AP)
MBS6328250-02 5x 0.2 mL

OR1Q1, CT (OR1Q1, OR1Q2, OR1Q3, Olfactory receptor 1Q1, OST226, Olfactory receptor 1Q2, Olfactory receptor 1Q3, Olfactory receptor 9-A, Olfactory receptor OR9-25, Olfactory receptor TPCR106) (AP)

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein 78 (TMEM78), partial
MBS7057876 Inquire

Recombinant Human Transmembrane protein 78 (TMEM78), partial

Sign In for Pricing
View Details
Bevirimat
M20655-01 1 g

Bevirimat

Sign In for Pricing
View Details
Bevirimat
M20655-02 200 mg

Bevirimat

Sign In for Pricing
View Details