Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr735 3'UTR GFP Stable Cell Line
TU165469 1.0 mL

Olfr735 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Gm10413 shRNA (UAS) - Lentiviral mouse Gm10413 shRNA (UAS, iRFP) (25)
GTR15217946 1 Vial

Lentiviral mouse Gm10413 shRNA (UAS) - Lentiviral mouse Gm10413 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rno-miR-511-5p inhibitor
HY-RI04507-01 5 nmol

Rno-miR-511-5p inhibitor

Sign In for Pricing
View Details
Rno-miR-511-5p inhibitor
HY-RI04507-02 20 nmol

Rno-miR-511-5p inhibitor

Sign In for Pricing
View Details
Beclin-1 mouse Monoclonal Antibody (5C5)
BT-MCA0211-01 20 µL

Beclin-1 mouse Monoclonal Antibody (5C5)

Sign In for Pricing
View Details
Beclin-1 mouse Monoclonal Antibody (5C5)
BT-MCA0211-02 50 µL

Beclin-1 mouse Monoclonal Antibody (5C5)

Sign In for Pricing
View Details