Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ROPN1L sgRNA gene knockout kit - Lentiviral human ROPN1L sgRNA gene knockout kit (100)
GTR15380902 1 Vial

Lentiviral human ROPN1L sgRNA gene knockout kit - Lentiviral human ROPN1L sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
IL17RC, NT (IL17RC, Interleukin-17 receptor C, Interleukin-17 receptor homolog, Interleukin-17 receptor-like protein, ZcytoR14) (Biotin) discontinued
036982-Biotin 200 µL

IL17RC, NT (IL17RC, Interleukin-17 receptor C, Interleukin-17 receptor homolog, Interleukin-17 receptor-like protein, ZcytoR14) (Biotin) discontinued

Sign In for Pricing
View Details
Goat Polyclonal RBFOX3/NeuN Antibody [Alexa Fluor 647]
NBP3-05554AF647 0.1 mL

Goat Polyclonal RBFOX3/NeuN Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
4-Hydroxynonenal Antibody, Clone 12F7: RPE
MBS808716-01 0.1 mg

4-Hydroxynonenal Antibody, Clone 12F7: RPE

Sign In for Pricing
View Details
4-Hydroxynonenal Antibody, Clone 12F7: RPE
MBS808716-02 5x 0.1 mg

4-Hydroxynonenal Antibody, Clone 12F7: RPE

Sign In for Pricing
View Details
Rabbit anti-SH3GL2 Antibody
MBS4507809-01 0.05 mL

Rabbit anti-SH3GL2 Antibody

Sign In for Pricing
View Details