Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nhlh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4331306 1.0 µg DNA

Nhlh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
KIR2DL1 Protein Vector (Human) (pPM-C-HA)
PV022715 500 ng

KIR2DL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig) -like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10) (MaxLight 405) discontinued
K1862-38C-ML405 100 µL

KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig) -like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Tubulin/HDAC-IN-1
HY-150772 1 Each

Tubulin/HDAC-IN-1

Sign In for Pricing
View Details
GRK4 Mouse Monoclonal Antibody [Clone ID: OTI4F5]
TA805974 100 µL

GRK4 Mouse Monoclonal Antibody [Clone ID: OTI4F5]

Sign In for Pricing
View Details
Influenza A H1N1 Antibody (FITC)
GWB-A3EF8E 1 mL

Influenza A H1N1 Antibody (FITC)

Sign In for Pricing
View Details