Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF II p68 discontinued
542853-01 30ul

TAF II p68 discontinued

Sign In for Pricing
View Details
TAF II p68 discontinued
542853-02 100 µL

TAF II p68 discontinued

Sign In for Pricing
View Details
DUSP19 Antibody, HRP conjugated
A65721-100UG 100 µg

DUSP19 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mepolizumab Biosimilar - Research Grade
ICH5677-5mg 5 mg

Mepolizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Biotin-MBP Derivatized Peptide
M41378-01 100 mg

Biotin-MBP Derivatized Peptide

Sign In for Pricing
View Details
Biotin-MBP Derivatized Peptide
M41378-02 25 mg

Biotin-MBP Derivatized Peptide

Sign In for Pricing
View Details