Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma, 2, AAG1, DAP5, FLJ41344, NAT1, p97) (Biotin)
MBS6173995-01 0.1 mL

EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma, 2, AAG1, DAP5, FLJ41344, NAT1, p97) (Biotin)

Sign In for Pricing
View Details
EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma, 2, AAG1, DAP5, FLJ41344, NAT1, p97) (Biotin)
MBS6173995-02 5x 0.1 mL

EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma, 2, AAG1, DAP5, FLJ41344, NAT1, p97) (Biotin)

Sign In for Pricing
View Details
SLC1A7 Rabbit Polyclonal Antibody
TA321773 100 µL

SLC1A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human MRVI1 shRNA (UAS) - Lentiviral human MRVI1 shRNA (UAS, iRFP) plasmid
GTR15315571 1 Vial

Lentiviral human MRVI1 shRNA (UAS) - Lentiviral human MRVI1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Goat Anti-paraneoplastic Ma antigen 2 antibody ELISA Kit
MBS750693-01 48 Well

Goat Anti-paraneoplastic Ma antigen 2 antibody ELISA Kit

Sign In for Pricing
View Details
Goat Anti-paraneoplastic Ma antigen 2 antibody ELISA Kit
MBS750693-02 96 Well

Goat Anti-paraneoplastic Ma antigen 2 antibody ELISA Kit

Sign In for Pricing
View Details