Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-JunD Rabbit Monoclonal Antibody
MBS1750057-01 0.03 mL

Anti-JunD Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-JunD Rabbit Monoclonal Antibody
MBS1750057-02 0.1 mL

Anti-JunD Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-JunD Rabbit Monoclonal Antibody
MBS1750057-03 5x 0.1 mL

Anti-JunD Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Olr429 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV627830 1.0 µg DNA

Olr429 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Human Stathmin 2 (STMN2)
RPU59820-01 50 µg

Recombinant Human Stathmin 2 (STMN2)

Sign In for Pricing
View Details
Recombinant Human Stathmin 2 (STMN2)
RPU59820-02 100 µg

Recombinant Human Stathmin 2 (STMN2)

Sign In for Pricing
View Details