Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) Antibody (HSV1/1934) [Alexa Fluor 750]
NBP3-08632AF750 100 µL

Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) Antibody (HSV1/1934) [Alexa Fluor 750]

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555
MBS4517141-01 0.1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555
MBS4517141-02 0.5 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555
MBS4517141-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555
MBS4517141-04 5x 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 555

Sign In for Pricing
View Details
HMX2 ORF Vector (Human) (pORF)
ORF013285 1.0 µg DNA

HMX2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details