Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-HSA
C050110-10ml 10ml

HRP-HSA

Sign In for Pricing
View Details
UPK1B Antibody (C-term)
MBS9206821-01 0.08 mL

UPK1B Antibody (C-term)

Sign In for Pricing
View Details
UPK1B Antibody (C-term)
MBS9206821-02 0.4 mL

UPK1B Antibody (C-term)

Sign In for Pricing
View Details
UPK1B Antibody (C-term)
MBS9206821-03 5x 0.4 mL

UPK1B Antibody (C-term)

Sign In for Pricing
View Details
PLA2G7 (Platelet-activating Factor Acetylhydrolase, PAF Acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine Esterase, 2-acetyl-1-alkylglycerophosphocholine Esterase, Group-VIIA Phospholipase A2, gVIIA-PLA2, LDL-associated Phospholipase A2, LDL-PLA (2), PAF 2-acylhydrolase, PAFAH) (Biotin)
131428-Biotin 100 µL

PLA2G7 (Platelet-activating Factor Acetylhydrolase, PAF Acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine Esterase, 2-acetyl-1-alkylglycerophosphocholine Esterase, Group-VIIA Phospholipase A2, gVIIA-PLA2, LDL-associated Phospholipase A2, LDL-PLA (2), PAF 2-acylhydrolase, PAFAH) (Biotin)

Sign In for Pricing
View Details
PCDHB10 Protein Vector (Rat) (pPM-C-HA)
PV292704 500 ng

PCDHB10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details