Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-human-cho-his.html

Purity

96.50

Smiles

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

285 (Gene_ID) O15123-1 (Y19-F496) (Accession)

Molecular Weight

Approximately 62.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD3 (B-3) : m-IgGκ BP-HRP Bundle
sc-524028 1 Kit

FXYD3 (B-3) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
2-Phenylacetamidine
TRC-P319130-2.5G 2.5 g

2-Phenylacetamidine

Sign In for Pricing
View Details
Rat cryptosporidium (Cry) antibody ELISA Kit
MBS2600427-01 48 Well

Rat cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Rat cryptosporidium (Cry) antibody ELISA Kit
MBS2600427-02 96 Well

Rat cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Rat cryptosporidium (Cry) antibody ELISA Kit
MBS2600427-03 5x 96 Well

Rat cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Rat cryptosporidium (Cry) antibody ELISA Kit
MBS2600427-04 10x 96 Well

Rat cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details