Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (His)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-his.html

Purity

92

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatidylcholine (SGMS2) Antibody (FITC)
abx310324-01 20 µg

Phosphatidylcholine (SGMS2) Antibody (FITC)

Sign In for Pricing
View Details
Phosphatidylcholine (SGMS2) Antibody (FITC)
abx310324-02 50 µg

Phosphatidylcholine (SGMS2) Antibody (FITC)

Sign In for Pricing
View Details
Phosphatidylcholine (SGMS2) Antibody (FITC)
abx310324-03 100 µg

Phosphatidylcholine (SGMS2) Antibody (FITC)

Sign In for Pricing
View Details
Phosphatidylcholine (SGMS2) Antibody (FITC)
abx310324-04 200 µg

Phosphatidylcholine (SGMS2) Antibody (FITC)

Sign In for Pricing
View Details
Phosphatidylcholine (SGMS2) Antibody (FITC)
abx310324-05 1 mg

Phosphatidylcholine (SGMS2) Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Wfikkn1 shRNA (UAS) - Lentiviral mouse Wfikkn1 shRNA (UAS, RFP) (25)
GTR15238079 1 Vial

Lentiviral mouse Wfikkn1 shRNA (UAS) - Lentiviral mouse Wfikkn1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details