Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45B, Human (His)

GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45b-protein-human-his.html

Purity

98.0

Smiles

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Molecular Formula

4616 (Gene_ID) O75293 (M1-R160) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

30X Mini GeBAflex-tube, 25 kDa MWCO, Floating rack, Handbook
D070-25-30 Each

30X Mini GeBAflex-tube, 25 kDa MWCO, Floating rack, Handbook

Ask
View Details
PF9601N 200mg
A22075-200 200 mg

PF9601N 200mg

Ask
View Details
Rabbit Polyclonal Ninein Antibody [Alexa Fluor 750]
NBP2-97595AF750 0.1 mL

Rabbit Polyclonal Ninein Antibody [Alexa Fluor 750]

Ask
View Details
Lentiviral mouse Rpl7a shRNA (UAS) - Lentiviral mouse Rpl7a shRNA (UAS, GFP) plasmid
GTR15190822 1 Vial

Lentiviral mouse Rpl7a shRNA (UAS) - Lentiviral mouse Rpl7a shRNA (UAS, GFP) plasmid

Ask
View Details