Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSST-1, S. aureus (His-SUMO)

TSST-1 protein induces symptoms related to toxic shock syndrome. TSST-1 Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived TSST-1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

TSST-1 Protein, S. aureus (His-SUMO), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tsst-1-protein-s-aureus-his-sumo.html

Purity

96

Smiles

STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Molecular Formula

/ (Gene_ID) P06886 (S41-N234) (Accession)

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACS2 Human Over-expression Lysate
orb1344295 100 µg

PACS2 Human Over-expression Lysate

Sign In for Pricing
View Details
SNORD29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44854111 3x 1.0 µg

SNORD29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Spacer C3 5 umol scale
26-6439-06 1 Each

Spacer C3 5 umol scale

Sign In for Pricing
View Details
OSBPL3 (NM_145320) Human Tagged ORF Clone Lentiviral Particle
RC224731L1V 200 µL

OSBPL3 (NM_145320) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MAPK11 Mouse mAb
E2220176 100 µL

MAPK11 Mouse mAb

Sign In for Pricing
View Details
Human Cluster Of Differentiation 160 (CD160) ELISA Kit
MBS2019865-01 24 Strip Well

Human Cluster Of Differentiation 160 (CD160) ELISA Kit

Sign In for Pricing
View Details