Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA125, Human (HEK293, His)

CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells[1][2][3][4][5][6][7].

Product Specifications

Product Name Alternative

CA125 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ca125-protein-human-hek293-his.html

Purity

95.00

Smiles

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMHHHHHH

Molecular Formula

94025 (Gene_ID) Q8WXI7 (G12660-M12923) (Accession)

Molecular Weight

40-80 kDa

References & Citations

[1]Claudia Seelenmeyer, et al. The cancer antigen CA125 represents a novel counter receptor for galectin-1. J Cell Sci. 2003 Apr 1;116 (Pt 7) :1305-18.|[2]Jacobs I, et al. The CA 125 tumour-associated antigen: a review of the literature. Hum Reprod. 1989 Jan;4 (1) :1-12.|[3]Plana A, et al. Radiologically enlarged cardiophrenic lymph nodes and CA-125 in relation to diaphragmatic carcinomatosis, surgical outcome, and overall survival in advanced ovarian cancer. Acta Oncol. 2023 May;62 (5) :451-457.|[4]Zhang R, et al. Molecular Biomarkers for the Early Detection of Ovarian Cancer. Int J Mol Sci. 2022 Oct 10;23 (19) :12041. |[5]Yamashita T, et al. Cancer Antigen 125 Expression Enhances the Gemcitabine/Cisplatin-Resistant Tumor Microenvironment in Bladder Cancer. Am J Pathol. 2023 Mar;193 (3) :350-361. |[6]Kobayashi H, et al. A human/mouse chimeric monoclonal antibody against CA125 for radioimmunoimaging of ovarian cancer. Cancer Immunol Immunother. 1993 Aug;37 (3) :143-9. |[7]Saga T, et al. An antibody-tumor model for the targeting of CA125-producing gynecologic malignancies[J]. Japanese journal of cancer research, 1990, 81 (11) : 1141-1148.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Raspberry ketone
M18780-01 1 g

Raspberry ketone

Ask
View Details
Raspberry ketone
M18780-02 200 mg

Raspberry ketone

Ask
View Details
Raspberry ketone
M18780-03 500 mg

Raspberry ketone

Ask
View Details
Raspberry ketone
M18780-04 100 mg

Raspberry ketone

Ask
View Details
Histone H3 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-33042M-BF555 100 µL

Histone H3 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
Lentiviral human ACE2 shRNA (UAS) - Lentiviral human ACE2 shRNA (UAS, RFP) (100)
GTR15337587 1 Vial

Lentiviral human ACE2 shRNA (UAS) - Lentiviral human ACE2 shRNA (UAS, RFP) (100)

Ask
View Details