Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human is the recombinant human-derived FGF-12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human.html

Purity

95.0

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGD1559896 Protein Vector (Rat) (pPM-C-HA)
39200026 500 ng

RGD1559896 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
GENLISA™ Human Alanine aminotransferase 1 (AAT1) ELISA
KBH3753 1x 96 Well

GENLISA™ Human Alanine aminotransferase 1 (AAT1) ELISA

Ask
View Details
Lentiviral human TCF25 sgRNA gene knockout kit - Lentiviral human TCF25 sgRNA gene knockout kit (plasmid)
GTR15378317 1 Vial

Lentiviral human TCF25 sgRNA gene knockout kit - Lentiviral human TCF25 sgRNA gene knockout kit (plasmid)

Ask
View Details
Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit
MBS9916983-01 48 Well

Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit

Ask
View Details
Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit
MBS9916983-02 96 Well

Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit

Ask
View Details
Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit
MBS9916983-03 5x 96 Well

Human Mannan-Binding Lectin Serine Protease 3 (MASP3) ELISA Kit

Ask
View Details