Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human is the recombinant human-derived FGF-12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human.html

Purity

95.0

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF594 conjugate, 0.1mg/mL
BNC941920-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details