Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2A, Human (HEK293, His)

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (HEK293, His) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

NKG2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2a-protein-human-hek-293-his.html

Purity

98.0

Smiles

RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Molecular Formula

3821 (Gene_ID) P26715-1 (R100-L233) (Accession)

Molecular Weight

25-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Betaxolol Impurity 18
RM-B050118-01 10 mg

Betaxolol Impurity 18

Sign In for Pricing
View Details
Betaxolol Impurity 18
RM-B050118-02 100 mg

Betaxolol Impurity 18

Sign In for Pricing
View Details
Betaxolol Impurity 18
RM-B050118-03 25 mg

Betaxolol Impurity 18

Sign In for Pricing
View Details
Betaxolol Impurity 18
RM-B050118-04 50 mg

Betaxolol Impurity 18

Sign In for Pricing
View Details
Mouse Gremlin 1 (GREM1) ELISA Kit
abx571065 96 Well

Mouse Gremlin 1 (GREM1) ELISA Kit

Sign In for Pricing
View Details
COX18 (NM_173827) Human Untagged Clone
SC306934 10 µg

COX18 (NM_173827) Human Untagged Clone

Sign In for Pricing
View Details