Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

Product Specifications

Product Name Alternative

Protein E7

Abbreviation

Recombinant Human papillomavirus type 16 E7 protein

Gene Name

E7

UniProt

P03129

Expression Region

1-98aa

Organism

Human papillomavirus type 16

Target Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC (CSB-EP015270HU-B), the EC50 is 268.1-354.3 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT3a Antibody
3227-100 100 µg

DNMT3a Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS8513144-01 0.05 mg

LONP2 Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS8513144-02 0.1 mg

LONP2 Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS8513144-03 0.1 mL (AF750)

LONP2 Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS8513144-04 0.1 mL (AF405M)

LONP2 Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS8513144-05 0.1 mL (AF546)

LONP2 Antibody

Sign In for Pricing
View Details