NDRG1, Human (His)
NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
NDRG1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ndrg1-protein-human-his.html
Purity
95.0
Smiles
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Molecular Formula
10397 (Gene_ID) Q92597 (M1-C394) (Accession)
Molecular Weight
Approximately 50.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS965353 Inquire
Recombinant Rabbit Sarcoplasmic reticulum histidine-rich calcium-binding protein (HRC), partial
Sign In for Pricing
View Details 
bs-0037R-BF555-01 20 µL
AIF Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details bs-0037R-BF555-02 100 µL
AIF Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details 
12942151 3x 1.0 µg DNA
B3GNT7 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details