Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG1, Human (His)

NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NDRG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ndrg1-protein-human-his.html

Purity

95.0

Smiles

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Molecular Formula

10397 (Gene_ID) Q92597 (M1-C394) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MeCP2 Antibody [DyLight 594]
NBP2-50060DL594 0.1 mL

Rabbit Polyclonal MeCP2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ)
MBS1100107 Inquire

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ)

Sign In for Pricing
View Details
Mouse GXYLT2 shRNA Plasmid
abx981959-01 150 µg

Mouse GXYLT2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GXYLT2 shRNA Plasmid
abx981959-02 300 µg

Mouse GXYLT2 shRNA Plasmid

Sign In for Pricing
View Details
APOC3 Rabbit monoclonal antibody
BS40577-01 50 µL

APOC3 Rabbit monoclonal antibody

Sign In for Pricing
View Details
APOC3 Rabbit monoclonal antibody
BS40577-02 100 µL

APOC3 Rabbit monoclonal antibody

Sign In for Pricing
View Details