Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF168 Protein Vector (Mouse) (pPM-C-HA)
40267024 500 ng

RNF168 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Trichomonas Vaginalis Ferredoxin Protein (aa 9-100)
VAng-Cr4599-50gEcoli 50 µg (E. coli)

Recombinant Trichomonas Vaginalis Ferredoxin Protein (aa 9-100)

Sign In for Pricing
View Details
FAM72C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV724961 1.0 µg DNA

FAM72C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rnf157 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4465903 1.0 µg DNA

Rnf157 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ascochlorin
A105-0.5MG 0.5 mg

Ascochlorin

Sign In for Pricing
View Details
MGLL (Monoglyceride Lipase)
485802 100 µL

MGLL (Monoglyceride Lipase)

Sign In for Pricing
View Details