Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5AL1 sgRNA CRISPR Lentivector set (Human)
K0146901 3x 1.0 µg

ATP5AL1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
RABGGTA Protein Vector (Human) (pPM-C-HA)
38384021 500 ng

RABGGTA Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - AF568
BS21698-01 100 µL

Rabbit Anti-Cat IgG (H&L) - AF568

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - AF568
BS21698-02 500 µL

Rabbit Anti-Cat IgG (H&L) - AF568

Sign In for Pricing
View Details
Lentiviral human RPS14 shRNA (UAS) - Lentiviral human RPS14 shRNA (UAS) (100)
GTR15087138 1 Vial

Lentiviral human RPS14 shRNA (UAS) - Lentiviral human RPS14 shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-COL4A2/Collagen IV Alpha2 Antibody (N-Terminus)
MBS2401775-01 0.05 mL

Anti-COL4A2/Collagen IV Alpha2 Antibody (N-Terminus)

Sign In for Pricing
View Details