Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCRTR1 Polyclonal Antibody
RD266336A-01 60 μL

HCRTR1 Polyclonal Antibody

Sign In for Pricing
View Details
HCRTR1 Polyclonal Antibody
RD266336A-02 120 μL

HCRTR1 Polyclonal Antibody

Sign In for Pricing
View Details
HCRTR1 Polyclonal Antibody
RD266336A-03 200 µL

HCRTR1 Polyclonal Antibody

Sign In for Pricing
View Details
Dek sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3772304 1.0 µg DNA

Dek sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Tlcd5 activation kit by CRISPRa
GA214611 1 Kit

Mouse Tlcd5 activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC18 sgRNA CRISPR Lentivector set (Human)
K0373901 3x 1.0 µg

CCDC18 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details