Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPST2, CT (Protein-tyrosine Sulfotransferase 2, Tyrosylprotein Sulfotransferase 2, TPST-2) (MaxLight 550) discontinued
T2040-37A-ML550 100 µL

TPST2, CT (Protein-tyrosine Sulfotransferase 2, Tyrosylprotein Sulfotransferase 2, TPST-2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal AZI2 Antibody [mFluor Violet 610 SE]
NBP2-97191MFV610 0.1 mL

Rabbit Polyclonal AZI2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
FBL2 Double Nickase Plasmid (m2)
sc-428267-NIC-2 20 µg

FBL2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
DDX27 3'UTR Luciferase Stable Cell Line
TU005714 1.0 mL

DDX27 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ARL11 Human qPCR Template Standard (BC013150)
HK200025 1 Kit

ARL11 Human qPCR Template Standard (BC013150)

Sign In for Pricing
View Details
N-Hydroxyl-tryptamine
TRC-H884220-50MG 50 mg

N-Hydroxyl-tryptamine

Sign In for Pricing
View Details