Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin-1 (7C8) Alexa Fluor® 790
sc-53564 AF790 200 µg/mL

Caveolin-1 (7C8) Alexa Fluor® 790

Sign In for Pricing
View Details
EEF2 (Elongation Factor 2, Eukaryotic Translation Elongation Factor 2)
479914 100 µL

EEF2 (Elongation Factor 2, Eukaryotic Translation Elongation Factor 2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081783-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081783-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081783-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081783-04 1 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details