Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fndc10 shRNA (UAS) - Lentiviral mouse Fndc10 shRNA (UAS, GFP) plasmid
GTR15280534 1 Vial

Lentiviral mouse Fndc10 shRNA (UAS) - Lentiviral mouse Fndc10 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Shigella Sonnei ulaA Protein (aa 1-465)
VAng-0278Lsx-1mgYeast 1 mg (Yeast)

Recombinant Shigella Sonnei ulaA Protein (aa 1-465)

Sign In for Pricing
View Details
Sagittal Slices, 1 mm (For mice 40 to 75g)
RBMA-200S 1 Each

Sagittal Slices, 1 mm (For mice 40 to 75g)

Sign In for Pricing
View Details
ADARB2 Recombinant Protein (Rat)
RP189248 100 µg

ADARB2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Hephaestin (HEPH) ELISA Kit
RD-HEPH-Hu-01 96 Tests

Human Hephaestin (HEPH) ELISA Kit

Sign In for Pricing
View Details
Human Hephaestin (HEPH) ELISA Kit
RD-HEPH-Hu-02 48 Tests

Human Hephaestin (HEPH) ELISA Kit

Sign In for Pricing
View Details