Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX1 Rabbit pAb
A17381 50 µL

DLX1 Rabbit pAb

Sign In for Pricing
View Details
LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9)
MBS6010683-01 0.2 mL

LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9)

Sign In for Pricing
View Details
LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9)
MBS6010683-02 5x 0.2 mL

LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9)

Sign In for Pricing
View Details
GPR34 Antibody; Biotin conjugated
MBS7005012-01 0.05 mg

GPR34 Antibody; Biotin conjugated

Sign In for Pricing
View Details
GPR34 Antibody; Biotin conjugated
MBS7005012-02 0.1 mg

GPR34 Antibody; Biotin conjugated

Sign In for Pricing
View Details
GPR34 Antibody; Biotin conjugated
MBS7005012-03 5x 0.1 mg

GPR34 Antibody; Biotin conjugated

Sign In for Pricing
View Details