Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2 Mouse Monoclonal Antibody [Clone ID: OTI4C5] (Angiotensin Converting Enzyme 2)
TA803844 100 µL

ACE2 Mouse Monoclonal Antibody [Clone ID: OTI4C5] (Angiotensin Converting Enzyme 2)

Sign In for Pricing
View Details
Olfr804 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4202207 1.0 µg DNA

Olfr804 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC40 Antibody [Alexa Fluor 750]
NBP3-06274AF750 0.1 mL

Rabbit Polyclonal CCDC40 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Dehydro Epiandrosterone Tosylate
445993-01 10 mg

Dehydro Epiandrosterone Tosylate

Sign In for Pricing
View Details
Dehydro Epiandrosterone Tosylate
445993-02 25 mg

Dehydro Epiandrosterone Tosylate

Sign In for Pricing
View Details
Recombinant Human CYP3A4 Protein, N-His
YHC35401 100 μg

Recombinant Human CYP3A4 Protein, N-His

Sign In for Pricing
View Details