Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdcd2 sgRNA CRISPR Lentivector set (Rat)
K6843101 3x 1.0 µg

Pdcd2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Glucocerebrosidase (FITC)
547117 200 µL

Glucocerebrosidase (FITC)

Sign In for Pricing
View Details
Phospho-BORA (Ser497) Peptide
AF8249-BP 1 mg

Phospho-BORA (Ser497) Peptide

Sign In for Pricing
View Details
3’-Hydroxy Repaglinide Ethyl Ester (Mixture of Diastereomers)
014474 1 mg

3’-Hydroxy Repaglinide Ethyl Ester (Mixture of Diastereomers)

Sign In for Pricing
View Details
CD273 (CD273 Antigen, B7-DC, bA574F11.2, Btdc, Butyrophilin B7-DC, Butyrophilin B7DC, MGC142238, MGC142240, Programmed Cell Death 1 Ligand 2, PD-1 Ligand 2, PDCD1 Ligand 2, PDCD1L2, PDCD1LG2, Programmed Death Ligand 2, PDL2, PD-L2) (FITC) discontinued
C2549-21B4 100 µg

CD273 (CD273 Antigen, B7-DC, bA574F11.2, Btdc, Butyrophilin B7-DC, Butyrophilin B7DC, MGC142238, MGC142240, Programmed Cell Death 1 Ligand 2, PD-1 Ligand 2, PDCD1 Ligand 2, PDCD1L2, PDCD1LG2, Programmed Death Ligand 2, PDL2, PD-L2) (FITC) discontinued

Sign In for Pricing
View Details
HLF1-11
MBS5815753 Inquire

HLF1-11

Sign In for Pricing
View Details