Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYG-409 100mg
A24461-100 100 mg

LYG-409 100mg

Sign In for Pricing
View Details
Monoclonal MUC2 (Mucin 2) Antibody, Clone: MLP/842
AMM01082G 7 ml

Monoclonal MUC2 (Mucin 2) Antibody, Clone: MLP/842

Sign In for Pricing
View Details
Btbd1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6321802 1.0 µg DNA

Btbd1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV674197 1.0 µg DNA

CA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GPR87 Protein Vector (Human) (pPB-N-His)
PV052802 500 ng

GPR87 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Immortalized NF1 Plexiform Neurofribroma Cell Line (ipNF00.6) - hTERT
T0192 1x106 cells / 1.0 mL

Immortalized NF1 Plexiform Neurofribroma Cell Line (ipNF00.6) - hTERT

Sign In for Pricing
View Details