Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf36 Antibody (Center) Blocking peptide
MBS9219840-01 0.5 mg

C7orf36 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
C7orf36 Antibody (Center) Blocking peptide
MBS9219840-02 5x 0.5 mg

C7orf36 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
ZCCHC11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV704493 1.0 µg DNA

ZCCHC11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Bacillus anthracis Spore Antigen (Anthrax) discontinued
B0003-05G8 100 µg

Bacillus anthracis Spore Antigen (Anthrax) discontinued

Sign In for Pricing
View Details
Manidipine dihydrochloride 50mg
A10554-50 50 mg

Manidipine dihydrochloride 50mg

Sign In for Pricing
View Details
Slc9a8 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6683602 1.0 µg DNA

Slc9a8 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details