Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL14 AAV Vector (Rat) (CMV)
40843106 1 µg

RPL14 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Human SAMSN1 Recombinant Protein
PROTQ9NSI8-250ug 250 µg

Human SAMSN1 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 7/17 Antibody (C-46) [PE]
NBP3-08343PE 100 µL

Mouse Monoclonal Cytokeratin 7/17 Antibody (C-46) [PE]

Sign In for Pricing
View Details
Human Gastric Cancer Tumor Cells
ABC-TC151W 1 Vial

Human Gastric Cancer Tumor Cells

Sign In for Pricing
View Details
SUV39H1 Rabbit pAb
E47R5708 100 µL

SUV39H1 Rabbit pAb

Sign In for Pricing
View Details
PPLK/GFP+Puro-DANCR shRNA (3+1)
PPL02204-3 1 Each

PPLK/GFP+Puro-DANCR shRNA (3+1)

Sign In for Pricing
View Details