Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
CF810992 100 µg

CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]

Sign In for Pricing
View Details
Bovine secretory component, SC ELISA Kit
QY-E60017 96 Tests

Bovine secretory component, SC ELISA Kit

Sign In for Pricing
View Details
Giardia A+B One-Step PCR kit
Oneq-H685-100D 100T

Giardia A+B One-Step PCR kit

Sign In for Pricing
View Details
Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit
MBS8801067-01 48 Well

Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit

Sign In for Pricing
View Details
Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit
MBS8801067-02 96 Well

Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit

Sign In for Pricing
View Details
Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit
MBS8801067-03 5x 96 Well

Human IDO (Indoleamine-2, 3-Dioxygenase) ELISA Kit

Sign In for Pricing
View Details