Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KHDC1L Protein
E30P11746 20 µg

Recombinant Human KHDC1L Protein

Sign In for Pricing
View Details
GP183 Polyclonal Antibody
RA32510-01 50 µL

GP183 Polyclonal Antibody

Sign In for Pricing
View Details
GP183 Polyclonal Antibody
RA32510-02 100 µL

GP183 Polyclonal Antibody

Sign In for Pricing
View Details
Dusp8 (NM_001108510) Rat Tagged ORF Clone
RR213577 10 µg

Dusp8 (NM_001108510) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Tbc1d19 sgRNA CRISPR Lentivector set (Mouse)
K3116101 3x 1.0 µg

Tbc1d19 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
HPAF-II/STAT3 Reporter (Luc) stable cell line
GTR15423479 1 Vial

HPAF-II/STAT3 Reporter (Luc) stable cell line

Sign In for Pricing
View Details