Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-lactamase TEM/Bla, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His), E.coli, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-lactamase-tem-bla-protein-p-pastoris-his.html

Purity

90.0

Smiles

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Molecular Formula

/ (Gene_ID) P62593 (H24-W286) (Accession)

Molecular Weight

Approximately 30.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prcp shRNA (UAS) - Lentiviral mouse Prcp shRNA (UAS, iRFP) (100)
GTR15168207 1 Vial

Lentiviral mouse Prcp shRNA (UAS) - Lentiviral mouse Prcp shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RLN2 Protein Vector (Human) (pPB-N-His)
PV057226 500 ng

RLN2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)
MBS1348370-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)
MBS1348370-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)
MBS1348370-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)
MBS1348370-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF094 (ERF094)

Sign In for Pricing
View Details