Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum aestivum Alpha-amylase/trypsin inhibitor CM3

Product Specifications

Product Name Alternative

(Chloroform/methanol-soluble protein CM3)

Abbreviation

Recombinant Triticum aestivum Alpha-amylase/trypsin inhibitor CM3 protein

UniProt

P17314

Expression Region

26-168aa

Organism

Triticum aestivum (Wheat)

Target Sequence

SGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha-amylase/trypsin inhibitor. It could be involved in insect defense mechanisms.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.3 kDa

References & Citations

"N-terminal amino acid sequence of chloroform/methanol-soluble proteins and albumins from endosperm of wheat, barley and related species." Shewry P.R., Lafiandra D., Salcedo G., Aragoncillo C., Garcia-Olmedo F., Lew E.J.-L., Dietler M.D., Kasarda D.D. FEBS Lett. 175:359-363 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ricin Antibody
abx461799-01 100 µg

Ricin Antibody

Sign In for Pricing
View Details
Ricin Antibody
abx461799-02 1 mg

Ricin Antibody

Sign In for Pricing
View Details
BTC Antibody
DF7038-01 100 µL

BTC Antibody

Sign In for Pricing
View Details
BTC Antibody
DF7038-02 200 µL

BTC Antibody

Sign In for Pricing
View Details
Rabbit anti-human Syndecan-1/CD138(SDC1) polyclonal Antibody
MBS716913-01 0.1 mL

Rabbit anti-human Syndecan-1/CD138(SDC1) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Syndecan-1/CD138(SDC1) polyclonal Antibody
MBS716913-02 5x 0.1 mL

Rabbit anti-human Syndecan-1/CD138(SDC1) polyclonal Antibody

Sign In for Pricing
View Details