Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG/CXCL9, Rabbit (His-SUMO)

The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIG/CXCL9 Protein, Rabbit (His-SUMO), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mig-cxcl9-protein-rabbit-his-sumo.html

Smiles

SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

Molecular Formula

103350772 (Gene_ID) U3KNX2 (S23-A124) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAT Human Gene Knockout Kit (CRISPR)
KN401146 1 Kit

PLAT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prosc (BC061045) Mouse Tagged ORF Clone
MG201110 10 µg

Prosc (BC061045) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Complement C5 Recombinant Rabbit monoclonal Antibody
HA725127H 100 µL

Human Complement C5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HRP Conjugate Stabilizer, Non-Mammalian-based, 1X
6347 100 mL

HRP Conjugate Stabilizer, Non-Mammalian-based, 1X

Sign In for Pricing
View Details
WY 45233 Succinate
TRC-W950013-250MG 250 mg

WY 45233 Succinate

Sign In for Pricing
View Details
PIK3AP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H6]
TA501764AM 100 µL

PIK3AP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H6]

Sign In for Pricing
View Details