MIG/CXCL9, Rabbit (His-SUMO)
The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIG/CXCL9 Protein, Rabbit (His-SUMO), Rabbit, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mig-cxcl9-protein-rabbit-his-sumo.html
Smiles
SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
Molecular Formula
103350772 (Gene_ID) U3KNX2 (S23-A124) (Accession)
Molecular Weight
27.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Human SFTPD/SP-D Protein (Glu22Gly, His Tag)
Recombinant Human SFTPD/SP-D Protein (Glu22Gly, His Tag)
