Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Cynomolgus (HEK293, His)

FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and -klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2]. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-21 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYAS

Molecular Formula

102126624 (Gene_ID) A0A2K5UYN8/XM_005589811.2 (H29-S209) (Accession)

Molecular Weight

Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Integral membrane protein 2B (ITM2B) ELISA kit
GTR10456239 96 Well

Guinea Pig Integral membrane protein 2B (ITM2B) ELISA kit

Sign In for Pricing
View Details
Rat PLK2 siRNA
abx928962-01 15 nmol

Rat PLK2 siRNA

Sign In for Pricing
View Details
Rat PLK2 siRNA
abx928962-02 30 nmol

Rat PLK2 siRNA

Sign In for Pricing
View Details
Goat Transcription factor SOX-3 (SOX3) ELISA Kit
GTR10320726 96 Well

Goat Transcription factor SOX-3 (SOX3) ELISA Kit

Sign In for Pricing
View Details
Duck Serine Incorporator 1 (SERINC1) ELISA Kit
MBS9932829 Inquire

Duck Serine Incorporator 1 (SERINC1) ELISA Kit

Sign In for Pricing
View Details
Fruquintinib Impurity 4
RM-F182104-01 10 mg

Fruquintinib Impurity 4

Sign In for Pricing
View Details