Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melanoma-associated antigen B2 (MAGEB2)

Product Specifications

CAS Number

9000-83-3

Gene Name

MAGEB2

UniProt

O15479

Expression Region

1-319aa

Organism

Homo sapiens

Target Sequence

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Field of Research

Cancer

Assay Type

Developed Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Urinary bladder
CS716822 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
VEZT (NM_017599) Human Recombinant Protein
TP314205M 100 µg

VEZT (NM_017599) Human Recombinant Protein

Sign In for Pricing
View Details
Human KLK3, Tag Free
HA211208-01 20 µg

Human KLK3, Tag Free

Sign In for Pricing
View Details
Human KLK3, Tag Free
HA211208-02 50 µg

Human KLK3, Tag Free

Sign In for Pricing
View Details
Human KLK3, Tag Free
HA211208-03 100 µg

Human KLK3, Tag Free

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559213 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details