Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melanoma-associated antigen B2 (MAGEB2)

Product Specifications

CAS Number

9000-83-3

Gene Name

MAGEB2

UniProt

O15479

Expression Region

1-319aa

Organism

Homo sapiens

Target Sequence

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Field of Research

Cancer

Assay Type

Developed Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110BX 500 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF647 conjugate, 0.1mg/mL
BNC471994-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYBA (NM_000101) Human Over-expression Lysate
LC400029 20 µg

CYBA (NM_000101) Human Over-expression Lysate

Sign In for Pricing
View Details
CDC25C (NM_022809) Human Over-expression Lysate
LY429706 100 µg

CDC25C (NM_022809) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF488A conjugate, 0.1mg/mL
BNC881010-100 1x 100 µL

Cytochrome C (CYCS/1010), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Screen Quest™ Fluorimetric Fatty Acid Uptake Assay Kit
36385-AAT 100 Tests

Screen Quest™ Fluorimetric Fatty Acid Uptake Assay Kit

Sign In for Pricing
View Details