CDK4, Human (sf9, His, Flag, Avi)
CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G (1) /S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G (1) phase, releases E2F and promotes transcription of genes that drive G (1) progression. CDK4 Protein, Human (sf9, His, Flag, Avi) is the recombinant human-derived CDK4 protein, expressed by Sf9 insect cells, with Avi and N-His and N-Flag labeled tag.
Product Specifications
Product Name Alternative
CDK4 Protein, Human (sf9, His, Flag, Avi), Human, Sf9 insect cells
UNSPSC
12352202
Type
Reference compound
Purity
94
Smiles
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Molecular Formula
1019 (Gene_ID) P11802-1 (M1-E303) (Accession)
Molecular Weight
Approximately 38.7 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL311999V 500 µL Each
KCNMB1 Human shRNA Lentiviral Particle (Locus ID 3779)
Sign In for Pricing
View Details 
GTR15249046 1 Vial
Lentiviral mouse Ushbp1 shRNA (UAS) - Lentiviral mouse Ushbp1 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 