Lymphotactin/XCL1, Human (HEK293, Fc-His)
XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases[1]. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in HEK293 cells with six C-Terminal His-tags and a C-Terminal Fc-tag. It consists of 93 amino acids (V22-G114) .
Product Specifications
Product Name Alternative
Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lymphotactin-xcl1-protein-human-hek-293-fc-his.html
Smiles
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Molecular Formula
6375 (Gene_ID) P47992 (V22-G114) (Accession)
Molecular Weight
Approximately 54 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), CF594 conjugate, 0.1mg/mL
