Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ankyrin-3 (ANK3), partial

Product Specifications

Product Name Alternative

(ANK-3) (Ankyrin-G)

Abbreviation

Recombinant Human ANK3 protein, partial

Gene Name

ANK3

UniProt

Q12955

Expression Region

4088-4199aa

Organism

Homo sapiens (Human)

Target Sequence

ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

In skeletal muscle, required for costamere localization of DMD and betaDAG1 . Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg (2+) levels, and thereby contributes to the regulation of renal Mg (2+) reabsorption . [Isoform 5]: May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.1 kDa

References & Citations

"The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PSENEN sgRNA gene knockout kit - Lentiviral human PSENEN sgRNA gene knockout kit (100)
GTR15354774 1 Vial

Lentiviral human PSENEN sgRNA gene knockout kit - Lentiviral human PSENEN sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human Clusterin (CLU) Protein
abx065948-01 10 µg

Human Clusterin (CLU) Protein

Sign In for Pricing
View Details
Human Clusterin (CLU) Protein
abx065948-02 50 µg

Human Clusterin (CLU) Protein

Sign In for Pricing
View Details
Human Clusterin (CLU) Protein
abx065948-03 100 µg

Human Clusterin (CLU) Protein

Sign In for Pricing
View Details
Human Clusterin (CLU) Protein
abx065948-04 200 µg

Human Clusterin (CLU) Protein

Sign In for Pricing
View Details
Human Clusterin (CLU) Protein
abx065948-05 500 µg

Human Clusterin (CLU) Protein

Sign In for Pricing
View Details