Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH2 Antibody

Rabbit polyclonal antibody to ALDH2

Product Specifications

Product Name Alternative

Acetaldehyde dehydrogenase 2 antibody, Aldehyde dehydrogenase 2 family (mitochondrial) antibody, Aldehyde dehydrogenase 2 family antibody, Aldehyde dehydrogenase mitochondrial antibody, Aldehyde dehydrogenase, mitochondrial antibody, ALDH 2 antibody, ALDH class 2 antibody, ALDH E2 antibody, ALDH-E2 antibody, Aldh2 antibody, ALDH2_HUMAN antibody, ALDHI antibody, ALDM antibody, Liver mitochondrial ALDH antibody, MGC1806 antibody, Mitochondrial aldehyde dehydrogenase 2 antibody, MS767 antibody, Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody

Reactivity

Human, Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Target

ALDH2

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Metabolism Research

Purification

Immunogen affinity purified.

Dilution

Western blot: 0.1-0.5μg/ml. Immunohistochemistry (Paraffin-embedded Section) : 0.5-1μg/ml

Form

Lyophilized

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC-P, WB

Preservative

Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 550)
MBS6254560-01 0.1 mL

CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 550)

Sign In for Pricing
View Details
CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 550)
MBS6254560-02 5x 0.1 mL

CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 550)

Sign In for Pricing
View Details
SMAD4 Antibody [C22D20]
C15507-100uL*2 2x 100μL

SMAD4 Antibody [C22D20]

Sign In for Pricing
View Details
IRF2 Rabbit Polyclonal Antibody (Carrier-free)
orb3076420 100 µg

IRF2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
H-Ser-His-OH (Standard)
HY-126488R-01 5 mg

H-Ser-His-OH (Standard)

Sign In for Pricing
View Details
H-Ser-His-OH (Standard)
HY-126488R-02 10 mg

H-Ser-His-OH (Standard)

Sign In for Pricing
View Details