Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF13 Antibody

Rabbit polyclonal antibody to TNFSF13

Product Specifications

Product Name Alternative

A proliferation inducing ligand antibody, A proliferation-inducing ligand antibody, APRIL antibody, CD 256 antibody, CD256 antibody, CD256 antigen antibody, Ligand antibody, PRO715 antibody, Proliferation inducing ligand APRIL antibody, TALL 2 antibody, TALL-2 antibody, TALL2 antibody, TNF and APOL related leukocyte expressed ligand 2 antibody, TNF related death ligand 1 antibody, TNF related death ligand antibody, TNF- and APOL-related leukocyte expressed ligand 2 antibody, TNF-related death ligand 1 antibody, TNF13_ HUMAN antibody, TNFSF 13 antibody, TNFSF13 antibody, TNFSF13 protein antibody, TRDL 1 antibody, TRDL-1 antibody, TRDL1 antibody, Tumor necrosis factor (ligand) superfamily member 13 antibody, Tumor necrosis factor (ligand) superfamily, member 13 antibody, Tumor necrosis factor ligand superfamily member 13 antibody, Tumor necrosis factor like protein ZTNF2 antibody, Tumor necrosis factor related death ligand antibody, Tumor necrosis factor related death ligand 1 antibody, Tumor necrosis factor superfamily member 13 antibody, TWE PRIL antibody, UNQ383 antibody, UNQ383/ PRO715 antibody, ZTNF 2 antibody, ZTNF2 antibody

Reactivity

Human

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.

Target

TNFSF13

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Immunogen affinity purified.

Dilution

Western blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml

Form

Lyophilized

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Tested Applications

ELISA, WB

Preservative

Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9343998-01 48 Well

Hamster Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9343998-02 96 Well

Hamster Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9343998-03 5x 96 Well

Hamster Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9343998-04 10x 96 Well

Hamster Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (FITC)
126188-FITC 100 µL

EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (FITC)

Sign In for Pricing
View Details
Procyanidin B4
M31990-01 100 mg

Procyanidin B4

Sign In for Pricing
View Details