Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2V2, Human (His)

UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (His) is the recombinant human-derived UBE2V2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2V2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2v2-protein-human-his.html

Purity

98.0

Smiles

MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Molecular Formula

7336 (Gene_ID) Q15819 (M1-N145) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSK Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV660857 1.0 µg DNA

CSK Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
LIPE Protein Vector (Rat) (pPM-C-His)
PV277673 500 ng

LIPE Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
AdipoR agonist 1
orb2564364-01 25 mg

AdipoR agonist 1

Sign In for Pricing
View Details
AdipoR agonist 1
orb2564364-02 50 mg

AdipoR agonist 1

Sign In for Pricing
View Details
AdipoR agonist 1
orb2564364-03 100 mg

AdipoR agonist 1

Sign In for Pricing
View Details
Olr346 (NM_001000255) Rat Untagged Clone
RN201461 10 µg

Olr346 (NM_001000255) Rat Untagged Clone

Sign In for Pricing
View Details