Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-mouse-his.html

Purity

98.0

Smiles

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Formula

21926 (Gene_ID) P06804 (L80-L235) (Accession)

Molecular Weight

Approximately 18.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]de Kossodo S, et al. Tumor necrosis factor alpha is involved in mouse growth and lymphoid tissue development. J Exp Med. 1992 Nov 1;176 (5) :1259-64.|[2]Mueller C, et al. Noncleavable transmembrane mouse tumor necrosis factor-alpha (TNFalpha) mediates effectsdistinct from those of wild-type TNFalpha in vitro and in vivo. J Biol Chem. 1999 Dec 31;274 (53) :38112-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RERE, NT (RERE, ARG, ARP, ATN1L, KIAA0458, Arginine-glutamic acid dipeptide repeats protein, Atrophin-1-like protein, Atrophin-1-related protein) (APC) discontinued
040961-APC 200 µL

RERE, NT (RERE, ARG, ARP, ATN1L, KIAA0458, Arginine-glutamic acid dipeptide repeats protein, Atrophin-1-like protein, Atrophin-1-related protein) (APC) discontinued

Ask
View Details
ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) APC
MBS6377207-01 0.1 mL

ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) APC

Ask
View Details
ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) APC
MBS6377207-02 5x 0.1 mL

ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) APC

Ask
View Details
Human Trefoil Factor 1 (TFF1) Protein
abx655845-01 100 µg

Human Trefoil Factor 1 (TFF1) Protein

Ask
View Details
Human Trefoil Factor 1 (TFF1) Protein
abx655845-02 200 µg

Human Trefoil Factor 1 (TFF1) Protein

Ask
View Details
Human Trefoil Factor 1 (TFF1) Protein
abx655845-03 500 µg

Human Trefoil Factor 1 (TFF1) Protein

Ask
View Details