Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-mouse-his.html

Purity

98.0

Smiles

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Formula

21926 (Gene_ID) P06804 (L80-L235) (Accession)

Molecular Weight

Approximately 18.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]de Kossodo S, et al. Tumor necrosis factor alpha is involved in mouse growth and lymphoid tissue development. J Exp Med. 1992 Nov 1;176 (5) :1259-64.|[2]Mueller C, et al. Noncleavable transmembrane mouse tumor necrosis factor-alpha (TNFalpha) mediates effectsdistinct from those of wild-type TNFalpha in vitro and in vivo. J Biol Chem. 1999 Dec 31;274 (53) :38112-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PRDM14 knockout cell line
ABC-KH12096 1 Vial

Human PRDM14 knockout cell line

Ask
View Details
Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)
MBS7033411-01 0.02 mg

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)

Ask
View Details
Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)
MBS7033411-02 0.1 mg

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)

Ask
View Details
Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)
MBS7033411-03 5x 0.1 mg

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)

Ask
View Details
Bovine Caspase-6 (CASP6) ELISA Kit-Sandwich
EK11F884-01 48 Test

Bovine Caspase-6 (CASP6) ELISA Kit-Sandwich

Ask
View Details
Bovine Caspase-6 (CASP6) ELISA Kit-Sandwich
EK11F884-02 96 Tests

Bovine Caspase-6 (CASP6) ELISA Kit-Sandwich

Ask
View Details