Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2A/Activin RIIA, Mouse (HEK293, His)

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 134 amino acids (M1-P134) .

Product Specifications

Product Name Alternative

ACVR2A/Activin RIIA Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2a-activin-riia-protein-mouse-hek293-his.html

Purity

95.80

Smiles

AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP

Molecular Formula

11480 (Gene_ID) P27038 (A20-P134) (Accession)

Molecular Weight

Approximately 35 kDa

References & Citations

[1]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[2]V K Chin, et al. Inhibition of Activin A suppressed tumor necrosis factor-α secretion and improved histopathological conditions in malarial mice. Trop Biomed. 2021 Mar 1;38 (1) :187-204.|[3]Szabina Szófia Szilágyi, et al. Competition between type I activin and BMP receptors for binding to ACVR2A regulates signaling to distinct Smad pathways. BMC Biol. 2022 Feb 18;20 (1) :50.|[4]Heather L Hayes, et al. A Pdx-1-Regulated Soluble Factor Activates Rat and Human Islet Cell Proliferation. Mol Cell Biol. 2016 Nov 14;36 (23) :2918-2930.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 56A1 Polyclonal Antibody
RA28171-01 50 µL

Olfactory receptor 56A1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 56A1 Polyclonal Antibody
RA28171-02 100 µL

Olfactory receptor 56A1 Polyclonal Antibody

Sign In for Pricing
View Details
RNASE9 (NM_001110361) Human Over-expression Lysate
LH02573V 100 µg

RNASE9 (NM_001110361) Human Over-expression Lysate

Sign In for Pricing
View Details
OR14C36 3'UTR Lenti-reporter-Luc Vector
34977081 1.0 µg

OR14C36 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BSN ELISA Kit (Mouse)
OKEH05598-96W 96 Tests

BSN ELISA Kit (Mouse)

Sign In for Pricing
View Details
GALT Lentiviral Activation Particles (h2)
sc-405717-LAC-2 200 µL

GALT Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details