Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stromelysin-1/MMP-3, Human (HEK293, His)

The Stromelysin-1/MMP-3 protein is a multifunctional metalloprotease that degrades a variety of extracellular matrix components and activates molecules such as growth factors, plasminogen, and MMP9. It is released into the ECM and is activated through the plasmin cascade. Stromelysin-1/MMP-3 Protein, Human (HEK293, His) is the recombinant human-derived Stromelysin-1/MMP-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Stromelysin-1/MMP-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stromelysin-1-mmp-3-protein-human-hek-293-his.html

Purity

98.0

Smiles

YPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Molecular Formula

4314 (Gene_ID) P08254 (Y18-C477) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Dog IL6 Polyclonal Antibody
PQC15801 100 μg

Anti-Dog IL6 Polyclonal Antibody

Sign In for Pricing
View Details
Gm5887 Recombinant Protein (Mouse)
RP138386 100 µg

Gm5887 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Hsd3b1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
23946114 3x 1.0 µg

Hsd3b1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Olfactory Receptor 13D1
326687-01 50 µg

Olfactory Receptor 13D1

Sign In for Pricing
View Details
Olfactory Receptor 13D1
326687-02 100 µg

Olfactory Receptor 13D1

Sign In for Pricing
View Details
FAIM3 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb887926 100 µL

FAIM3 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details