Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDOST, Human

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

DDOST Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ddost-protein-human.html

Purity

95.00

Smiles

SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Molecular Formula

1650 (Gene_ID) P39656-1 (S43-P427) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1675 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34128126 3x 1.0µg DNA

Olr1675 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mmu-miR-431-5p miRNA Agomir
orb1918756-01 5 nmol

Mmu-miR-431-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-431-5p miRNA Agomir
orb1918756-02 10 nmol

Mmu-miR-431-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-431-5p miRNA Agomir
orb1918756-03 20 nmol

Mmu-miR-431-5p miRNA Agomir

Sign In for Pricing
View Details
KIR2DL3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
25705151 3x 1.0 µg DNA

KIR2DL3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
NE Purified mouse IgG3, κ Isotype Control
E16FMCY005K-500U 500 µg

NE Purified mouse IgG3, κ Isotype Control

Sign In for Pricing
View Details