Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDOST, Human

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

DDOST Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ddost-protein-human.html

Purity

95.00

Smiles

SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Molecular Formula

1650 (Gene_ID) P39656-1 (S43-P427) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PMEL17/SILV Antibody (SPM286) [Alexa Fluor 532]
NBP2-34755AF532 0.1 mL

Mouse Monoclonal PMEL17/SILV Antibody (SPM286) [Alexa Fluor 532]

Sign In for Pricing
View Details
Recombinant Human SPTY2D1 Protein
E30P10442 20 µg

Recombinant Human SPTY2D1 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal ABH1 Antibody [HRP]
NBP2-98658H 0.1 mL

Rabbit Polyclonal ABH1 Antibody [HRP]

Sign In for Pricing
View Details
mPR Gamma Polyclonal Antibody
JOT-AP05542-01 50ul

mPR Gamma Polyclonal Antibody

Sign In for Pricing
View Details
mPR Gamma Polyclonal Antibody
JOT-AP05542-02 100ul

mPR Gamma Polyclonal Antibody

Sign In for Pricing
View Details
Human Periaxin ELISA Kit
MBS2882531-01 48 Well

Human Periaxin ELISA Kit

Sign In for Pricing
View Details