Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDOST, Human

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

DDOST Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ddost-protein-human.html

Purity

95.00

Smiles

SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Molecular Formula

1650 (Gene_ID) P39656-1 (S43-P427) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lys-γ3-MSH (human) TFA
orb1981605-01 5 mg

Lys-γ3-MSH (human) TFA

Sign In for Pricing
View Details
Lys-γ3-MSH (human) TFA
orb1981605-02 50 mg

Lys-γ3-MSH (human) TFA

Sign In for Pricing
View Details
Rabbit Polyclonal Connexin 58/GJA9 Antibody
NBP1-59196 100 µL

Rabbit Polyclonal Connexin 58/GJA9 Antibody

Sign In for Pricing
View Details
OR5B15P 3'UTR Luciferase Stable Cell Line
TU016603 1.0 mL

OR5B15P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Nanos homolog 3 (NANOS3) ELISA Kit
orb1654641-01 48 Tests

Mouse Nanos homolog 3 (NANOS3) ELISA Kit

Sign In for Pricing
View Details
Mouse Nanos homolog 3 (NANOS3) ELISA Kit
orb1654641-02 96 Tests

Mouse Nanos homolog 3 (NANOS3) ELISA Kit

Sign In for Pricing
View Details